DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG43742

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:228 Identity:65/228 - (28%)
Similarity:102/228 - (44%) Gaps:35/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFN 236
            |.:.:.|||:||....||||||||  :....:.|..||.:......:.:|..|...::|.|..|:
  Fly    52 NNSEFFCGGSLIHKQYVLTAAHCV--RDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFH 114

  Fly   237 KGSLYNDVAVMLLESPFTLQENIQTVCL-------PNVGDKFDFDRCYATGWGKNKFGKDGEYQV 294
            .....||:|::.||.....:.:|:.:|:       .|..:.|.     |.||||.:.|...:   
  Fly   115 GNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFT-----AYGWGKTEHGNISD--- 171

  Fly   295 ILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQ-KNR 358
            :|..:|:..:|:..|..|:             :.||||.... |||:.|.|.||:.....: |:|
  Fly   172 VLSFIDLVRLPKSMCYQNI-------------NTICAGSTSG-DTCESDSGGPLIGNFVHRGKSR 222

  Fly   359 FKSAGIVAWG-IGCGEVNIPGVYASVAKLRPWI 390
            ....||.::| ..|.  .:.|||..|...:.||
  Fly   223 DILFGITSYGDAECS--GLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 65/228 (29%)
Tryp_SPc 153..390 CDD:214473 63/226 (28%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 63/226 (28%)
Tryp_SPc 35..256 CDD:238113 65/228 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.