DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP001244

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_321898.3 Gene:AgaP_AGAP001244 / 1281920 VectorBaseID:AGAP001244 Length:279 Species:Anopheles gambiae


Alignment Length:237 Identity:65/237 - (27%)
Similarity:103/237 - (43%) Gaps:47/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NLNLYE---CGGALIAPNVVLTAAHCVH-NKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYH 232
            :|..|:   ||.::|:....||||||:. :..|.:|.:.||.....|...|..     ...||.|
Mosquito    70 SLRSYDYHICGASIISSVWALTAAHCLFPDPDPRTISLLAGTGSQSTGGRIYN-----ATRIIIH 129

  Fly   233 EQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVG---------DKFDFDRCYATGWGKNKFGK 288
            ..:...::.|||||:.:.:.|:         .||.|         :.....|...||||:...| 
Mosquito   130 PMYAPSTMDNDVAVIRVNTHFS---------GPNTGYIGVVPLGYEPMAGVRAIVTGWGRQSEG- 184

  Fly   289 DGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIA 353
             .:..:.|..|::|:|.:.:|.......      ::....||| ||..||:|.||.|.|||    
Mosquito   185 -AKQSMTLAGVEIPIVDKAECMDQWSGV------LVSPQMICA-GELGKDSCNGDSGGPLV---- 237

  Fly   354 GQKNRFKSAGIVAWG-IGCGEVNIPGVYASV--AKLRPWIDA 392
               :..:..|||:|| ..||. .:..:|.::  |.:|.:|.:
Mosquito   238 ---SGGRQIGIVSWGSTKCGG-PLAAIYTNLGNAAIRTFISS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 64/234 (27%)
Tryp_SPc 153..390 CDD:214473 64/233 (27%)
AgaP_AGAP001244XP_321898.3 Tryp_SPc 53..266 CDD:214473 62/226 (27%)
Tryp_SPc 54..276 CDD:238113 65/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.