DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP011908

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_320621.4 Gene:AgaP_AGAP011908 / 1280755 VectorBaseID:AGAP011908 Length:391 Species:Anopheles gambiae


Alignment Length:263 Identity:73/263 - (27%)
Similarity:117/263 - (44%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGY-QNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK 198
            ||: :....||..:.| ||      |:..|:.:| :...:|:: |.||:|:...|||||||... 
Mosquito   146 CGWSRTAKIVGGSVAG-VN------EYTAMVGLL-DPLTVNVF-CSGAIISSRYVLTAAHCART- 200

  Fly   199 QPSSIVVRA--GEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQT 261
            .||...|:|  |:.|.::..:........:::||.||.:|:.:..||:|::...:.......:..
Mosquito   201 IPSVSRVQALVGDHDYRSGLDTPYSAIYNIEQIISHEYYNEQTRNNDIALLKTSTEMDFNRGVGP 265

  Fly   262 VCLPNVGDKFDFDRCYA--TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFIL 324
            :|||.....:.|.....  .|||...||  |....||:|..:.|:....|...          .:
Mosquito   266 ICLPFTYSTYSFGGLSVDIAGWGTTSFG--GPMSTILRKTTLNVLQNANCTAP----------YV 318

  Fly   325 HDSFIC--AGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLR 387
            :|..||  |.|   :|:|:.|.|..|.  :.|.: |..|.||:::|..|. .:.|.|...|....
Mosquito   319 NDQKICTFAVG---RDSCQYDSGGALF--LRGSQ-RMYSIGIISYGSACA-ASTPSVATRVTAYL 376

  Fly   388 PWI 390
            .||
Mosquito   377 SWI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 66/244 (27%)
Tryp_SPc 153..390 CDD:214473 64/242 (26%)
AgaP_AGAP011908XP_320621.4 CUB 26..>106 CDD:294042
Tryp_SPc 153..379 CDD:214473 69/254 (27%)
Tryp_SPc 154..382 CDD:238113 71/255 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.