DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:265 Identity:80/265 - (30%)
Similarity:120/265 - (45%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 AVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ---PSSIVVRAGEWD 211
            |..|.|....|||| |:|....:.:| .|||:||:...:|||||||..::   ...|..:..|:|
Mosquito    10 AYGQPARAYAFPWM-ALLETSVSDDL-PCGGSLISDRHILTAAHCVKARKRDCDDRIHFKDDEYD 72

  Fly   212 TQTQTEIRRHEDRY------------VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL 264
            :....|....|  |            ::.|:.|.:::..|..||:|::.|:.|..:..|:..:||
Mosquito    73 SGESEEADGAE--YSASCGPPAQRIPIETIVTHPKYSARSKRNDLAIIRLQYPAIIGYNVIPICL 135

  Fly   265 P--------NVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRH 321
            |        ...|.|      .||||   ..:.|:...:|:...:|.:|...|...::|  |.|.
Mosquito   136 PLTEQLRAYRPADSF------VTGWG---LTETGQRSAVLRYAILPALPLPDCAMRIKE--LDRI 189

  Fly   322 FILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGI-GCGEVNIPGVYASVAK 385
            .:|.|..:||||......|.||.|.||  .......||...|:|::|: .||....|||:|:|..
Mosquito   190 IVLDDGHLCAGGNNRTAHCHGDSGGPL--QYVSDSTRFVLQGVVSFGVKTCGTKIAPGVFANVTH 252

  Fly   386 LRPWI 390
            ...||
Mosquito   253 FIDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 79/262 (30%)
Tryp_SPc 153..390 CDD:214473 77/260 (30%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 78/263 (30%)
Tryp_SPc 9..257 CDD:238113 78/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.