DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP008861

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_319603.2 Gene:AgaP_AGAP008861 / 1279828 VectorBaseID:AGAP008861 Length:259 Species:Anopheles gambiae


Alignment Length:255 Identity:75/255 - (29%)
Similarity:124/255 - (48%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAG 208
            ||.|        :..|.|:.:: |||.|:.:   |||::|:|:.:||||||:.......:.:|||
Mosquito    34 GFPI--------DISEAPYQIS-LREGGHPS---CGGSIISPDWILTAAHCLEGVSADQVSIRAG 86

  Fly   209 EWDTQTQTEIRRHED--RYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQ-ENIQTVCLP--NVG 268
                   :..:.|..  |.|..::.|..::..:...|:|:|.||||..|. :.:.::.:|  :..
Mosquito    87 -------STYKMHGGVLRNVARVVLHPAWDPVTNEGDIALMELESPLPLDGDTMASIEMPEQDEE 144

  Fly   269 DKFDFDRCYATGWGK--NKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICA 331
            |..:..:...:||||  |:|    ...:||:...:|:|....|:...|.|.     .:.:..:||
Mosquito   145 DPVEGSKALVSGWGKTLNRF----HSALILRATFLPIVHRDNCQKAYRRTH-----TISEMMLCA 200

  Fly   332 G-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            | .|...|:|:||.|.|||....       ..|:|::.|||....:|||.|.|:.:|.||
Mosquito   201 GFFEGGHDSCQGDSGGPLVVDDV-------LVGVVSFAIGCARPGLPGVNARVSAVRDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 72/246 (29%)
Tryp_SPc 153..390 CDD:214473 70/244 (29%)
AgaP_AGAP008861XP_319603.2 Tryp_SPc 31..256 CDD:238113 75/255 (29%)
Tryp_SPc 31..253 CDD:214473 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.