DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP009966

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_319102.4 Gene:AgaP_AGAP009966 / 1279386 VectorBaseID:AGAP009966 Length:288 Species:Anopheles gambiae


Alignment Length:270 Identity:85/270 - (31%)
Similarity:128/270 - (47%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GC-----GYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAH 193
            ||     .|.:.||.  :|.|.|  ..:..::|:.:::.|     ..:.||.::|....:|||||
Mosquito    30 GCSRSAENYDHTNGE--RIVGGV--PVDIRDYPYQVSLRR-----GRHFCGESIIDSQWILTAAH 85

  Fly   194 CVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQEN 258
            |.......::.:..|........|..|     |:.|::|.:.|..|.| |.:::.|:.|..|.|:
Mosquito    86 CTRTINARNLWIHVGSSHVNDGGESVR-----VRRILHHPKQNSWSDY-DFSLLHLDQPLNLSES 144

  Fly   259 IQTVCL--PN----VGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETR 317
            :|.:.|  |:    .|:..|...|..:||| |....| |..::|:...:|:...|||.    |..
Mosquito   145 VQPIPLRKPSASEPTGELSDGTLCKVSGWG-NTHNPD-ESALVLRAATVPLTNHQQCS----EVY 203

  Fly   318 LGRHFILHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYA 381
            .|...:. :|.|||| .|..||:|:||.|.||||.  ||     ..|:|:||.||.|...|||||
Mosquito   204 EGIGSVT-ESMICAGYDEGGKDSCQGDSGGPLVCD--GQ-----LTGVVSWGKGCAEPGYPGVYA 260

  Fly   382 SVAKLRPWID 391
            .|:....||:
Mosquito   261 KVSTAYEWIE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/244 (31%)
Tryp_SPc 153..390 CDD:214473 75/243 (31%)
AgaP_AGAP009966XP_319102.4 Tryp_SPc 45..269 CDD:214473 78/250 (31%)
Tryp_SPc 46..272 CDD:238113 80/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.