DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP003960

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_318412.5 Gene:AgaP_AGAP003960 / 1278781 VectorBaseID:AGAP003960 Length:579 Species:Anopheles gambiae


Alignment Length:277 Identity:71/277 - (25%)
Similarity:118/277 - (42%) Gaps:31/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHN 197
            :.||.:..  |...||..:  |::.|::||.:|:.........|.|||:::..|.:||||||:..
Mosquito    27 QNCGKRKQ--VNLLITNGL--ESKEGDWPWHVALFHNNRRSFEYACGGSILDQNTILTAAHCLWL 87

  Fly   198 KQ----PSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQEN 258
            ..    ...::|:.|....:..:...|..:.|  |:|.|.::|...:.||:|::.|.:..|....
Mosquito    88 SNGLIAKERLLVQVGRSRLRVASIHARDHEAY--ELIVHPKYNVNQIANDIALIKLATDITFTNF 150

  Fly   259 IQTVCLPNVGDKFDFDRCYAT-----GWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRL 318
            :|.:||.|.||  |......|     |:|.::.....:   .|::..:|||....|..:.||...
Mosquito   151 VQPICLWNRGD--DQSSIVGTLGTVIGFGYDETDNPTD---TLREARLPVVSAIDCIQSNREAFA 210

  Fly   319 GRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPG----- 378
            .:   |.....|||.......|.||.|..|   .....|.:...|:|::.....:..|..     
Mosquito   211 TQ---LTSDMFCAGYRNGTSPCNGDSGGGL---FFNFNNVWYIRGLVSFTKPRQDTTICDTKEYT 269

  Fly   379 VYASVAKLRPWIDAKLK 395
            |:..|||...||:..|:
Mosquito   270 VFTDVAKYLRWIEQYLR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 64/251 (25%)
Tryp_SPc 153..390 CDD:214473 63/250 (25%)
AgaP_AGAP003960XP_318412.5 Tryp_SPc 39..283 CDD:238113 67/258 (26%)
Tryp_SPc 39..281 CDD:214473 65/256 (25%)
Tryp_SPc 331..573 CDD:214473
Tryp_SPc 331..573 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.