DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP004741

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_318080.4 Gene:AgaP_AGAP004741 / 1278484 VectorBaseID:AGAP004741 Length:315 Species:Anopheles gambiae


Alignment Length:334 Identity:86/334 - (25%)
Similarity:136/334 - (40%) Gaps:63/334 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RWLCA-NDTINTSGDGIIDIRL-----GTDAECKNYLDLCCDLPNKRKD--PIFEFKPDHPEGCG 136
            ||..| ..||:..|..:..:.:     ||     ..:.:.|:..|.:..  ||    |.|     
Mosquito     8 RWYTARRSTIHEQGGQLFMVIVLLCICGT-----TIVKVACNRTNSKLTAIPI----PRH----- 58

  Fly   137 YQNPNGVGFKITGAVN-QEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQP 200
             ..|..|...:...|| |.|..|:|||..:|....|. ::..|||:||....|||||||.::...
Mosquito    59 -DAPRTVRELLAKVVNGQTATTGQFPWQASIRAALGR-SVTVCGGSLIEAQWVLTAAHCANDYTV 121

  Fly   201 SSIVVRAGEWDTQTQTEIRRHEDRYVKEII---YHEQFNKGSLYNDVAVMLLESPFTLQENIQTV 262
            ..|.:.:          |..:..|.....:   .|.:|:...|.||||::.|.||......|..|
Mosquito   122 FQIGLGS----------IHLNMARLTMSTVIKFVHPEFDPWKLTNDVALIRLPSPVPYSLEIYPV 176

  Fly   263 CLP-NV--GDKFDFDRCYATGWGKNKFGKDG--EYQVILKKVDMPVVPEQQCETNLRETRLGRHF 322
            .|| |:  .|.:...:...:|:|:.   .|.  ....|||...|.::...:| ||:....     
Mosquito   177 KLPINLPPTDLYIGRQVTVSGFGRT---SDAIQSISTILKYERMRIISNAEC-TNVYGAA----- 232

  Fly   323 ILHDSFICA-GGEKD-KDTCKGDGGSPLVCPIAGQKNRFKSAGIVAW----GIGCGEVNIPGVYA 381
            |:.::.:|| |.|:. ::.|:||.|.|:|  :....:.:...|||::    |...|:   |..|.
Mosquito   233 IIRNTTLCAVGWERPYQNVCQGDSGGPMV--MQQDDSSWVQIGIVSFVSSRGCSTGD---PSGYI 292

  Fly   382 SVAKLRPWI 390
            .......|:
Mosquito   293 RTVNYLSWL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 68/252 (27%)
Tryp_SPc 153..390 CDD:214473 67/250 (27%)
AgaP_AGAP004741XP_318080.4 Tryp_SPc 70..300 CDD:214473 69/254 (27%)
Tryp_SPc 71..304 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.