DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP011427

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_317876.4 Gene:AgaP_AGAP011427 / 1278263 VectorBaseID:AGAP011427 Length:868 Species:Anopheles gambiae


Alignment Length:263 Identity:77/263 - (29%)
Similarity:114/263 - (43%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ITGAVNQEAEFGEFPWMLAI--LREEGNLNLYECGGALIAPNVVLTAAHCV---HNKQPSSIVVR 206
            |.|.....|..|||..|.||  .|.|.|:: |.|||:||....|||||||.   .|..|.:  ||
Mosquito    17 IQGLGGTRAYQGEFQHMAAIGWTRPENNID-YLCGGSLITLKFVLTAAHCAVDYANVPPDT--VR 78

  Fly   207 AGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL------- 264
            .|:.|..:..:....:...:...|.|.|:.:...|.|:|::.|.:.....:.:...|:       
Mosquito    79 LGDTDLASTDDDESAQQIPIARFIKHPQYRESRKYYDIALVELANVVDADDAVCVACVWREPEAP 143

  Fly   265 PNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFI 329
            .|:.|        |.|:|...||:  :....|:||.:..:...||...:...|......|.|..:
Mosquito   144 TNLLD--------AVGFGALGFGE--KLSPTLQKVQLRALSAVQCAERIPANRRQMPEGLRDDQL 198

  Fly   330 CAGGEKDKDTCKGDGGSPL---VCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID 391
            || ..|..|||:||.|.||   ...:.|:.... ..|:|::|..|.| ...|||..|:....||:
Mosquito   199 CA-HSKTMDTCEGDSGGPLQTEALDVFGETYPL-VVGVVSFGTPCIE-GSTGVYTRVSSYVEWIE 260

  Fly   392 AKL 394
            .::
Mosquito   261 KEV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/252 (29%)
Tryp_SPc 153..390 CDD:214473 73/251 (29%)
AgaP_AGAP011427XP_317876.4 Tryp_SPc 21..261 CDD:238113 75/255 (29%)
Tryp_SPc 21..259 CDD:214473 73/253 (29%)
Tryp_SPc 306..546 CDD:238113
Tryp_SPc 306..544 CDD:214473
Tryp_SPc 625..862 CDD:214473
Tryp_SPc 630..864 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.