DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP007795

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_317712.4 Gene:AgaP_AGAP007795 / 1278167 VectorBaseID:AGAP007795 Length:319 Species:Anopheles gambiae


Alignment Length:293 Identity:85/293 - (29%)
Similarity:127/293 - (43%) Gaps:37/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNL-YECGGALIAPNVVLTAAHCV--- 195
            || |.|......||  ..:.:..|:|||.:|:.|.|..|.: |.|||.::...||:||||||   
Mosquito    30 CG-QRPIAAPGTIT--YGRSSWPGQFPWHVALYRTEQPLTISYACGGFIVGERVVITAAHCVTAP 91

  Fly   196 --HNKQPSSIVVRAGEWDTQTQTEIRRH-EDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQE 257
              :......:.||.|.:|..|   :.|| ::..|..|..|..|..|||.:|:|:::|.:.....:
Mosquito    92 SGYQLAADELTVRVGLYDLLT---LARHSQEHRVGRIHRHGNFTTGSLRHDLALLMLRTIVEFGD 153

  Fly   258 NIQTVCLPNVGDKFDFDRC-YATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRH 321
            .:|.:|||...|.....|. ..:|||   ..:|......|:...||||....| .....|..|. 
Mosquito   154 FVQPICLPREPDALKGVRTGTVSGWG---LVEDDSPARTLRSATMPVVSYLSC-LQSDSTLFGP- 213

  Fly   322 FILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAW-GI----------GCGEVN 375
             :|:|...|||.|...:.|.||.|......:.|....|   |||:: |:          .|...:
Mosquito   214 -VLYDGMFCAGWENGTNVCNGDSGGAFAANVNGSWTAF---GIVSFTGVREHTDGQTPFRCDTKS 274

  Fly   376 IPGVYASVAKLRPWID--AKLKIWSIDPRHYTP 406
            :.| :.|:.....||:  |.::...:|.....|
Mosquito   275 LAG-FISIPMYLNWIESVAAVEAVQLDTHREMP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/256 (29%)
Tryp_SPc 153..390 CDD:214473 74/255 (29%)
AgaP_AGAP007795XP_317712.4 Tryp_SPc 41..291 CDD:238113 78/264 (30%)
Tryp_SPc 41..288 CDD:214473 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.