DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and TRY5_ANOGA

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_317174.2 Gene:TRY5_ANOGA / 1277691 VectorBaseID:AGAP008291 Length:274 Species:Anopheles gambiae


Alignment Length:275 Identity:73/275 - (26%)
Similarity:127/275 - (46%) Gaps:35/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGAL 182
            :|...|:..|.|:.|...|.:...|....|:.|          |:.:::..::.    :.|||::
Mosquito    27 HKLTRPVHRFAPNRPYLAGKRIVGGFVINISDA----------PYQISLQYDDD----HNCGGSI 77

  Fly   183 IAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVM 247
            ::...:||||||:::..||...||.|.....:...:.|     |..|:.|......:.| |:|::
Mosquito    78 LSSKWILTAAHCINDNAPSKPTVRVGSSKHASGGTVIR-----VARIVPHPMHGSKNNY-DIALL 136

  Fly   248 LLESPFTLQENIQTVCLPNVGDKFDFDRC-YATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCET 311
            .|::..|..|.:|.:.||...:..:.... ..:|||...  .:.:...:|:..::|.|.:|:| .
Mosquito   137 ELKNELTFSEKVQPIALPEQDEPIEEGTMGIVSGWGLTL--SEADSNDVLRATNVPTVNQQEC-N 198

  Fly   312 NLRETRLGRHFILHDSFICAGGEK-DKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVN 375
            ...::|.|.   :.|...|||.:: .:|||:.|.|.|.|.       :.|..|:::||..|....
Mosquito   199 KAYQSRYGG---ITDQMFCAGYKQGGQDTCRQDSGGPFVA-------KGKLIGVISWGHECALAG 253

  Fly   376 IPGVYASVAKLRPWI 390
            .|||||.||.:|.||
Mosquito   254 YPGVYARVASVRDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 64/240 (27%)
Tryp_SPc 153..390 CDD:214473 62/238 (26%)
TRY5_ANOGAXP_317174.2 Tryp_SPc 47..268 CDD:214473 65/253 (26%)
Tryp_SPc 48..271 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.