DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and TRY7_ANOGA

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_317172.2 Gene:TRY7_ANOGA / 1277689 VectorBaseID:AGAP008293 Length:267 Species:Anopheles gambiae


Alignment Length:284 Identity:85/284 - (29%)
Similarity:131/284 - (46%) Gaps:46/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYE 177
            |......|:.|:.:     |     ::|:|.|.:|.|..  |....:.|:.:::    ..:|.:.
Mosquito    18 CARAQPSRRHPLVQ-----P-----RSPHGSGHRIVGGF--EINVSDTPYQVSL----QYINSHR 66

  Fly   178 CGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDR----YVKEIIYHEQFNKG 238
            |||:::....|||||||....|..::.||.|.         .||...    .|..|:.|.::|:.
Mosquito    67 CGGSVLNSKWVLTAAHCTDGLQAFTLTVRLGS---------SRHASSGTVVNVARIVEHPKYNEY 122

  Fly   239 SLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDF-DRCYATGWGKNKFGKDGEYQVILKKVDMP 302
            :...|.|::.|||..|..:.:|.|.||...:..|. .....:|||..|...  |...||:..::|
Mosquito   123 NTDYDYALLELESELTFSDVVQPVALPEQDEAVDAGTMTIVSGWGSTKSAT--ESNAILRAANVP 185

  Fly   303 VVPEQQCETNLRETRLGRHFILHDSFICAGGEK-DKDTCKGDGGSPLVCPIAGQKNRFKSAGIVA 366
            .|.:::|    ||..  .|..:.|..:|||.:: .||.|:||.|.|||..       .|..|:|:
Mosquito   186 TVDQEEC----REAY--SHDAITDRMLCAGYQQGGKDACQGDSGGPLVAD-------GKLIGVVS 237

  Fly   367 WGIGCGEVNIPGVYASVAKLRPWI 390
            ||.||.:...|||||.||.:|.|:
Mosquito   238 WGSGCAQPGYPGVYARVAVVRNWV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/244 (31%)
Tryp_SPc 153..390 CDD:214473 75/242 (31%)
TRY7_ANOGAXP_317172.2 Tryp_SPc 41..261 CDD:214473 77/249 (31%)
Tryp_SPc 42..264 CDD:238113 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.