DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:257 Identity:80/257 - (31%)
Similarity:119/257 - (46%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PNGVGFKITGAVNQE-AEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSI 203
            |.| |.::   ||.| |:.|:||:.:.:....||.....|||:|:....||||.|||  ....|:
Mosquito    22 PRG-GMRV---VNGETAKLGQFPYQVRLTLHVGNGQQALCGGSLLNEEWVLTAGHCV--MLAKSV 80

  Fly   204 VVRAGEWDTQTQTEIRRHEDRYV---KEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLP 265
            .|..|..|....|    ::.|.|   .|...||::|...:.||||::.|.|.....|.:|.|.||
Mosquito    81 EVHLGAVDFSDNT----NDGRLVLESTEFFKHEKYNPLFVANDVALVKLPSKVEFSERVQPVRLP 141

  Fly   266 NVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFIC 330
            ...:.|.......:|||....|  |:....|:...:.|:|.:||:.....      .::..|.:|
Mosquito   142 TGDEDFAGREVVVSGWGLMVNG--GQVAQELQYATLKVIPNKQCQKTFSP------LLVRKSTLC 198

  Fly   331 AGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWG--IGCGEVNIPGVYASVAKLRPWI 390
            |.||:.:..|.||.|.|||  :|..|.   ..|:|::|  .||.:.: |..:|.|...|.|:
Mosquito   199 AVGEELRSPCNGDSGGPLV--LAEDKT---LVGVVSFGHAQGCDKGH-PAAFARVTAFRDWV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/244 (31%)
Tryp_SPc 153..390 CDD:214473 74/242 (31%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 76/249 (31%)
Tryp_SPc 28..257 CDD:238113 77/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.