DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP005594

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_315604.2 Gene:AgaP_AGAP005594 / 1276280 VectorBaseID:AGAP005594 Length:294 Species:Anopheles gambiae


Alignment Length:317 Identity:67/317 - (21%)
Similarity:109/317 - (34%) Gaps:64/317 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGA-------- 150
            |::.:...|.|.    ||:.      :.:|:.:..|:             |||...|        
Mosquito    12 GVVGVFANTSAA----LDVI------KVNPMSDETPE-------------GFKTMSAGTVVPYTY 53

  Fly   151 -----VNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAA-----HCVHNKQPSSIVV 205
                 ....|..|:||:...|.....|. ||:..||||..|.|:|.|     :.:|.......:.
Mosquito    54 SATYWYGYNAYAGQFPYHAEINFYTNNY-LYKRAGALITLNYVITPASSFHHYFIHGDMLYGYIT 117

  Fly   206 RAGEWDTQTQTE--IRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVG 268
            ....:::.||.|  |...|...|....:|  :.....|| :|::.|:.|......::.:.||.:.
Mosquito   118 LGSVFNSTTQWEQTINYTESSIVMHPFFH--YTNEDYYN-IAIIRLDRPAIQTRYVKPIRLPKLS 179

  Fly   269 DKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG 333
            |...:.....|..|..|  ::|     |..:..|::....|...|..      :..||...|...
Mosquito   180 DTRTYLAMEGTSCGTTK--EEG-----LSYLRNPLLSLSICRQQLTS------YTFHDQHYCTDV 231

  Fly   334 EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            .:....|....||.|.   ...:|.....|:|.....| ..:.|..|..::..|.||
Mosquito   232 YRGGSFCNRQCGSSLT---VEDENGPVLIGVVDLLFQC-SYSYPVRYVRLSAFREWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 56/245 (23%)
Tryp_SPc 153..390 CDD:214473 54/243 (22%)
AgaP_AGAP005594XP_315604.2 Tryp_SPc 60..285 CDD:304450 56/246 (23%)
Tryp_SPc 60..284 CDD:214473 54/244 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.