DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP010546

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_314515.4 Gene:AgaP_AGAP010546 / 1275277 VectorBaseID:AGAP010546 Length:295 Species:Anopheles gambiae


Alignment Length:245 Identity:86/245 - (35%)
Similarity:122/245 - (49%) Gaps:14/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GFK--ITGAVNQEAEFGEFPWMLAI--LREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ--PSS 202
            ||:  :..|....|...||..:.||  ...:|.:| :.|||:||..|.:||||||..|.:  |..
Mosquito    57 GFEGLVAPAYGNPALLREFAHIAAIGWTGADGKVN-WGCGGSLIWENFILTAAHCAANDEDVPPD 120

  Fly   203 IVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNV 267
             |.|.|:.:..:..:....:...:.::|.|:|....:.|.|||:|.||...|:.|.:...|| .:
Mosquito   121 -VARMGDLNIYSDDDDEFPQQLRIVKVIRHQQHRFSAKYYDVALMQLEKNITVHETVAPACL-WL 183

  Fly   268 GDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG 332
            .|:..|.:.||.|||:..||:|...  ||.|||:..:...||......:..|....||...:|||
Mosquito   184 DDEVRFPKLYAAGWGRTGFGEDKTN--ILLKVDLTPMNNTQCSKFYTSSERGLRNGLHAHHLCAG 246

  Fly   333 GEKDKDTCKGDGGSPL-VCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYA 381
            .|| .|||.||.|.|| |..:...|......|:.::|..||:.| |||||
Mosquito   247 DEK-MDTCPGDSGGPLHVKLLHNAKMTPFLVGVTSFGKPCGQAN-PGVYA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 83/234 (35%)
Tryp_SPc 153..390 CDD:214473 83/234 (35%)
AgaP_AGAP010546XP_314515.4 Tryp_SPc 67..295 CDD:214473 83/235 (35%)
Tryp_SPc 67..295 CDD:238113 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.