DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP010545

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_314514.4 Gene:AgaP_AGAP010545 / 1275276 VectorBaseID:AGAP010545 Length:876 Species:Anopheles gambiae


Alignment Length:273 Identity:79/273 - (28%)
Similarity:129/273 - (47%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 YQNPN----GVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHN 197
            |::.|    |..|.....:.:.|..|...|    .:.:|.: ::.|||:||..|.::|||||..|
Mosquito     7 YRHGNTGIVGPAFAKPAFLTEFAHIGAIGW----TQPDGKI-IWGCGGSLIWNNFIITAAHCTAN 66

  Fly   198 -KQPSSIVVRAGEWDTQTQTEIRRHEDRYVKE-----IIYHEQFNKGSLYNDVAVMLLESPFTLQ 256
             ...|..|||.|:.:..:.     .:|||.::     ||.|.:::..:.|.|:|:|.|::..::.
Mosquito    67 DDNVSPDVVRFGDLNIYSD-----EDDRYAQQLTIVSIIRHPKYSFSARYYDIALMKLDNNVSVH 126

  Fly   257 ENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQC-----ETNLRET 316
            |.:...|| .:..:..|....:.|||:..||:..  ..||.|:.:..:..:.|     .|.:|..
Mosquito   127 ETVAPACL-WLDKEVRFKELESAGWGQTGFGESP--TPILLKITLKPMSNENCTEHYTSTTVRGL 188

  Fly   317 RLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFK----SAGIVAWGIGCGEVNIP 377
            :.|    |....||||..| .|||.||.|.||...:   ::.:|    ..|:.::|..||:.: |
Mosquito   189 QRG----LDQHHICAGDAK-MDTCLGDSGGPLHIRL---QHNYKVTPFLVGLTSFGRPCGQSH-P 244

  Fly   378 GVYASVAKLRPWI 390
            |||..:|..|.||
Mosquito   245 GVYTRIAPFRSWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/253 (30%)
Tryp_SPc 153..390 CDD:214473 73/251 (29%)
AgaP_AGAP010545XP_314514.4 Trypsin 21..257 CDD:278516 73/257 (28%)
Tryp_SPc 47..260 CDD:238113 71/228 (31%)
Tryp_SPc 336..544 CDD:304450
Tryp_SPc 677..867 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.