DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP010528

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_314498.2 Gene:AgaP_AGAP010528 / 1275260 VectorBaseID:AGAP010528 Length:223 Species:Anopheles gambiae


Alignment Length:180 Identity:49/180 - (27%)
Similarity:69/180 - (38%) Gaps:44/180 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IDIRLGTD-----AECKNYLDLCCDLPNKR--KDPIFEFKPDHPEGC-GYQNPNGVGFKITGAVN 152
            |||.|..:     .|.:.:.|  |.|...|  ||.:     |.||.. .|:.|.  .:.....:.
Mosquito    27 IDIGLSEEDPFLTTEREEFDD--CHLRYMRYGKDEL-----DIPEPLRAYEEPR--DYSHIATIG 82

  Fly   153 QEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCV---HNKQPSSIVVRAGEWDTQT 214
            :....|...|              .|.||||..:||:|:|.|.   .|..||  |||.|  .|:.
Mosquito    83 RRRNGGTIDW--------------TCMGALIWDSVVITSAQCTTDEGNGIPS--VVRLG--GTKY 129

  Fly   215 QTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL 264
            ...|.      :||:|.|..|...:..||:|::.|:....:.|.....||
Mosquito   130 VQVIN------IKEVIRHPDFLPSNGQNDIALLQLDRKIIINETAVPTCL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 33/115 (29%)
Tryp_SPc 153..390 CDD:214473 33/115 (29%)
AgaP_AGAP010528XP_314498.2 Tryp_SPc 71..>173 CDD:304450 32/127 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.