DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP004570

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_313874.5 Gene:AgaP_AGAP004570 / 1274709 VectorBaseID:AGAP004570 Length:259 Species:Anopheles gambiae


Alignment Length:263 Identity:85/263 - (32%)
Similarity:131/263 - (49%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FKITGAVNQEAEF--------GEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPS 201
            |...||.|||...        .::|| ||.|..:|.   :.||.:|:..:.||||||||...:.:
Mosquito    10 FSECGAANQEIRIVGGRPTGVNQYPW-LARLVYDGQ---FHCGASLLTKDYVLTAAHCVRRLKRN 70

  Fly   202 SIVVRAGEWD----TQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTV 262
            .|.|..|::|    ::|...:|.     |..||.|..|::.|..:|:|::.|..|....:.|:.|
Mosquito    71 KIRVILGDYDQFVASETPAIMRA-----VTAIIRHRSFDQNSYNHDIALLKLRKPVEFTKTIRPV 130

  Fly   263 CLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCET-NLRETRLGRHFILHD 326
            |||....:.........|||:...|  |....:::.||:|::...||.: ..|.:|      :..
Mosquito   131 CLPKERSEPAGQLGTVVGWGRTSEG--GTLPALVQHVDVPILTLDQCRSMKYRASR------ITS 187

  Fly   327 SFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID 391
            :.:|||..| :|:|:||.|.||   :....::.:..|||:||:|||....||||..||:..||:.
Mosquito   188 NMLCAGKGK-QDSCQGDSGGPL---LVRNGDKHEIVGIVSWGVGCGRAGYPGVYTRVARYLPWLR 248

  Fly   392 AKL 394
            |.|
Mosquito   249 ANL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 79/250 (32%)
Tryp_SPc 153..390 CDD:214473 78/249 (31%)
AgaP_AGAP004570XP_313874.5 Tryp_SPc 21..246 CDD:214473 75/245 (31%)
Tryp_SPc 22..250 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.