DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:283 Identity:84/283 - (29%)
Similarity:134/283 - (47%) Gaps:32/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PIFEFKPDHPE------GCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGA 181
            |:|......|.      .||...|  :..:|.|.:  ..|...|.||.|:..:    |.:.|||:
Mosquito    83 PVFASDSSGPSQNCTPCKCGSVEP--INERIVGGI--PVEDNSFSWMAALYYD----NKFCCGGS 139

  Fly   182 LIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEII--YHEQFNKGSLYNDV 244
            |::...|:|||||..........|:.|..|  ....|....:|.||.|:  ::..||..   ||:
Mosquito   140 LLSDRYVITAAHCTTKPDRGLFRVQFGIND--RSKPIATSIERSVKRILTNWYNAFNNN---NDI 199

  Fly   245 AVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQC 309
            |::.|..|..:.:.:..:|||...:.::..|...||||:.|.|  |.....|.:.::|::..::|
Mosquito   200 ALLELTYPVAISDRVMPICLPQATEMYEGSRGIVTGWGRTKAG--GGLSGTLMQTEVPILTNREC 262

  Fly   310 ETNLRETRLGR-HFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCG 372
            .      |.|. .|.:.:..:|||. |..||:|:||.|.||.. :..:.|.::..|:|:||..|.
Mosquito   263 R------RAGYWAFQITNKMLCAGYLEGGKDSCQGDSGGPLQV-LNTKSNHYELVGVVSWGRACA 320

  Fly   373 EVNIPGVYASVAKLRPWIDAKLK 395
            :.|.|||||.|::...||:..:|
Mosquito   321 QKNFPGVYARVSQYLYWINRNIK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/241 (31%)
Tryp_SPc 153..390 CDD:214473 73/240 (30%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 75/247 (30%)
Tryp_SPc 111..341 CDD:238113 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.