DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP003691

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_313476.4 Gene:AgaP_AGAP003691 / 1274366 VectorBaseID:AGAP003691 Length:831 Species:Anopheles gambiae


Alignment Length:342 Identity:75/342 - (21%)
Similarity:122/342 - (35%) Gaps:92/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 IFEFKPDHPEGCGYQNPNGV-------GFKI--TGAVNQEAEFGEFPWMLAILREE--------- 170
            :|.|..|. ||......|.:       |:||  :...::.::|.:|...:|...:.         
Mosquito   192 VFNFGSDE-EGLALPVLNYIPWMEEVLGYKILPSECTSKYSDFRDFEDSMASRSDNFVQVQYSKS 255

  Fly   171 --GNLNLYE-----------------CGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQ--- 213
              .|.|:.:                 |.|:||||..|||||:|:...:.....:..|:::..   
Mosquito   256 RLSNTNIEQYKVRIVPKTAETGSKRHCYGSLIAPKFVLTAANCLRQYEVDGYTIEMGQYNVYYPV 320

  Fly   214 TQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESP-FTLQENIQTVCL-PNVGDKFDFDRC 276
            .:..||...:  .|:|.||.:|:..:|.||||::.:..| :|..:.:...|: |  .||...|..
Mosquito   321 QENSIRVRTE--AKKIHYHPEFDAATLANDVALLEIVKPLYTFNKTVLPACIWP--WDKLPVDEY 381

  Fly   277 YATGW------------GKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFI 329
            ...|:            ....|.....|...|.|     ||:.|                    .
Mosquito   382 QTNGYVPFNESDDESVRTNQFFATANVYDECLDK-----VPQHQ--------------------F 421

  Fly   330 CAG--GEKDKDTCKGDGGSPLVCPIAGQKNRFKSA-GIVAWGIGCGEVNIPGVYASVAKLRPWID 391
            |||  ......:|....||.:...:......|... .|.:.|..|| .|:|.||..:|....|||
Mosquito   422 CAGFPTALSPKSCHNSVGSAMSRSLYALGRYFDYIFAINSKGENCG-FNLPTVYTKIAPYVQWID 485

  Fly   392 AKLKIWSI----DPRHY 404
            :.:....:    |.::|
Mosquito   486 SIVHATKVHYEDDTKYY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 62/285 (22%)
Tryp_SPc 153..390 CDD:214473 61/284 (21%)
AgaP_AGAP003691XP_313476.4 Tryp_SPc 80..>152 CDD:304450
Tryp_SPc 276..484 CDD:214473 56/237 (24%)
Tryp_SPc 281..487 CDD:304450 59/235 (25%)
CLIP 506..554 CDD:197829
Tryp_SPc 600..820 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.