DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP003686

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_313469.4 Gene:AgaP_AGAP003686 / 1274361 VectorBaseID:AGAP003686 Length:368 Species:Anopheles gambiae


Alignment Length:335 Identity:83/335 - (24%)
Similarity:127/335 - (37%) Gaps:91/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LCCDL----------PNKRKDPIFEFKP------DHPE-------GCGYQNPNGVGFKITGAVN- 152
            :|||:          |..:........|      :||.       .||          :.|.|| 
Mosquito    73 VCCDVTAVQTTTTPAPTTQPPTTVAAAPATASLVNHPNIRLFDRTNCG----------LPGTVNK 127

  Fly   153 ----QEAEFGEFPWMLAILREEGNLNL--YECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWD 211
                |:|...::|||..|:........  .||.|.:|....|||||||:..:......||.||:|
Mosquito   128 IAFGQQARLFQYPWMAMIVYVSNTTGTESSECAGTIINVRYVLTAAHCIDGQMERMRYVRIGEYD 192

  Fly   212 TQTQTEIRRHED-------RY-VKEIIYHEQFNK----GSLYNDVAVMLLESPFTLQE-NIQTVC 263
            |:|..:.  .||       || |::.|:|..|.:    |   :|:.::.|........ ::..||
Mosquito   193 TRTDPDC--EEDTCAAPIQRYGVEDAIFHPNFTRIVRSG---HDIGLLRLNRSIDFSSGDVSPVC 252

  Fly   264 LPNVGDKFDFDRC--YATGWGKNKFGKDGEYQVILKKVDM-PV-----VPEQQCETNLRETRLGR 320
            ||.......||..  :.||||            :.::::: ||     :|...|.          
Mosquito   253 LPFTTGLMGFDPTLYWITGWG------------LTERLEVSPVLLQARIPPVSCS---------- 295

  Fly   321 HFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAK 385
               |....||||.......|:||.|.|:...:.....||...|:::.|..||...:||:.:.|:.
Mosquito   296 ---LSSYAICAGFGNATLHCEGDSGGPMKAQVPEYNFRFVQYGVISAGPRCGTQGVPGISSRVSF 357

  Fly   386 LRPWIDAKLK 395
            ...||...:|
Mosquito   358 FMQWILDNIK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 69/260 (27%)
Tryp_SPc 153..390 CDD:214473 68/259 (26%)
AgaP_AGAP003686XP_313469.4 CLIP 16..75 CDD:288855 0/1 (0%)
Tryp_SPc 131..362 CDD:214473 68/260 (26%)
Tryp_SPc 131..362 CDD:238113 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.