DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:283 Identity:96/283 - (33%)
Similarity:133/283 - (46%) Gaps:61/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ITGAV--NQEAEFGEFPWMLAI----LREEGN--LNLYE--CGGALIAPNVVLTAAHCVHN--KQ 199
            :.||:  ...|...|||.|..:    |:.:|.  ::.||  |||.||:...|||||||.|.  ..
Mosquito    22 VVGAIVGGDSATADEFPHMAVLGRSCLQADGGDCVDGYEWFCGGTLISDRFVLTAAHCAHTGMSH 86

  Fly   200 PSSIVVRAGEWDTQTQTEIRRHEDRY--VKEIIYHEQFNKGSLYNDVAVMLLESPF--------- 253
            |.: ||:.|..|.       |....|  |::::.|..:.....|||:|::.||||.         
Mosquito    87 PPT-VVQLGAHDL-------RRPALYVGVRDVVLHPGYGGVLAYNDIALIRLESPVASSIQPALL 143

  Fly   254 ----TLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLR 314
                |:.||:..:               |||||  |.|...:..:||::|.:|:||..||...|.
Mosquito   144 WRSETIPENVPLI---------------ATGWG--KLGHFEDPSMILQRVQIPIVPNSQCNQLLY 191

  Fly   315 ETRLGRHFILHDSFICAGGEK-DKDTCKGDGGSPL------VCPIAGQKNRFKSAGIVAWGIGCG 372
            .:|..||.:| .|.:|||... .||||:||.|.||      ..|| ||..|:...||.:.|..||
Mosquito   192 RSRRLRHGVL-PSQLCAGDPNGGKDTCEGDSGGPLQLKLPSARPI-GQAYRYYVVGITSNGGICG 254

  Fly   373 EVNIPGVYASVAKLRPWIDAKLK 395
            .|:.||:|..|:....|||..|:
Mosquito   255 TVDRPGLYTRVSSYAGWIDQVLE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 91/269 (34%)
Tryp_SPc 153..390 CDD:214473 90/268 (34%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 93/275 (34%)
Tryp_SPc 26..272 CDD:214473 90/272 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.