DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Ctrl

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:268 Identity:86/268 - (32%)
Similarity:125/268 - (46%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GCGYQNPNGVGFKITGAVN--------QEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLT 190
            |||..       .||.|::        :.|..|.:||.:::   :.|...:.|||:|||||.|:|
  Rat    18 GCGVP-------AITPALSYNQRIVNGENAVPGSWPWQVSL---QDNTGFHFCGGSLIAPNWVVT 72

  Fly   191 AAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTL 255
            ||||  ...|....|..||:|..:..|  ..:...:.:.|.|..:|..::.||:.::.|.||...
  Rat    73 AAHC--KVTPGRHFVILGEYDRSSNAE--PIQVLSISKAITHPSWNPNTMNNDLTLLKLASPARY 133

  Fly   256 QENIQTVCLPNVGDKFDFD-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLG 319
            ...:..|||.:..:..... .|..||||:.. |........|::|.:|:|...||    |:....
  Rat   134 TAQVSPVCLASSNEALPAGLTCVTTGWGRIS-GVGNVTPARLQQVVLPLVTVNQC----RQYWGS 193

  Fly   320 RHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQK-NRFKSAGIVAWGIGCGEVNIPGVYASV 383
            |   :.||.||||| ....:|:||.|.||||    || |.:...|||:||.....|..|.:|..|
  Rat   194 R---ITDSMICAGG-AGASSCQGDSGGPLVC----QKGNTWVLIGIVSWGTENCNVQAPAMYTRV 250

  Fly   384 AKLRPWID 391
            :|...||:
  Rat   251 SKFNTWIN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 79/239 (33%)
Tryp_SPc 153..390 CDD:214473 78/238 (33%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 78/243 (32%)
Tryp_SPc 34..260 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.