DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and LOC116411715

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_031760387.1 Gene:LOC116411715 / 116411715 -ID:- Length:386 Species:Xenopus tropicalis


Alignment Length:275 Identity:83/275 - (30%)
Similarity:132/275 - (48%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199
            ||.:.....|.:|.|..|...  |::|||::|....|....:.|||:::....|||||||..:.|
 Frog    30 CGNRPLFNKGSRIVGGQNSPP--GKWPWMVSIQSPTGKEFSHLCGGSVLNEIWVLTAAHCFKHLQ 92

  Fly   200 PSS------IVVRAGEWDT-QTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQE 257
            ...      :|..|..... ::..:||:     :||:|..:.:|..:..||:.::.|:.|....:
 Frog    93 RKEETKSWRLVFGANNLKVLESSVQIRK-----IKEVIQPKAYNPTTEANDITLLRLDKPIVFTD 152

  Fly   258 NIQTVCLP----NVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCET-NLRETR 317
            .:|..|.|    ||..|.|   ||..|||... .:.||...||::..:..:..::|.: :..:..
 Frog   153 YVQPACFPTEFANVEKKTD---CYIAGWGVLD-EESGEPSEILQEARVHQIDSKKCNSKDWYDGA 213

  Fly   318 LGRHFILHDSFICAGGEKDK-DTCKGDGGSPLVCPIAGQKNR-FKSAGIVAWGIGCGEVNIPGVY 380
            :|.:      .:|||.||.. |:|:||.|.||:|..  ||:| :...||.:||.||.....||||
 Frog   214 IGEY------NLCAGHEKGGIDSCQGDSGGPLMCKT--QKSRTYAVVGITSWGSGCARGKKPGVY 270

  Fly   381 ASVAKLRPWIDAKLK 395
            .|......||.:|::
 Frog   271 TSTKYFIKWIASKVE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/251 (30%)
Tryp_SPc 153..390 CDD:214473 74/250 (30%)
LOC116411715XP_031760387.1 Tryp_SPc 41..280 CDD:214473 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.