DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and LOC116407774

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_031749650.1 Gene:LOC116407774 / 116407774 -ID:- Length:319 Species:Xenopus tropicalis


Alignment Length:263 Identity:90/263 - (34%)
Similarity:135/263 - (51%) Gaps:18/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQP-SSIVVRAGE 209
            :|.|  .|.|...::||.:::....|.   :.|||:||....|::||||::|... |||||..|.
 Frog    31 RIMG--GQAAAQNKWPWQVSLRDTNGR---HFCGGSLINNKWVVSAAHCINNPSDLSSIVVFLGS 90

  Fly   210 W--DTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFD 272
            :  ....|.|||    ..|..||.|.:::|.|..||::::.||:...|.:.|..||||.....|.
 Frog    91 YMLSEPNQQEIR----VAVMRIIVHPRYDKYSSINDISLLELENEVVLTDAIIPVCLPTAAVTFP 151

  Fly   273 FD-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG-EK 335
            .. :|:|||||....|.......||::|.:|::..|.| :....|...:..|..:..||||. :.
 Frog   152 TGLKCWATGWGAILPGVPLPNPKILQEVALPMIDSQTC-SQYFSTPSTKAAISPNLMICAGYIDG 215

  Fly   336 DKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLKIWSID 400
            .||||:||.|.||||   .:.||:...|||::|..||:...|||...:.....||::.:...|.:
 Frog   216 GKDTCQGDSGGPLVC---SENNRWYLGGIVSYGASCGKPYRPGVNTFLPPFIGWIESTVPNISAN 277

  Fly   401 PRH 403
            .|:
 Frog   278 VRY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 85/242 (35%)
Tryp_SPc 153..390 CDD:214473 84/241 (35%)
LOC116407774XP_031749650.1 Tryp_SPc 32..270 CDD:238113 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.