DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CTRC

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:154 Identity:47/154 - (30%)
Similarity:73/154 - (47%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQN-PNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK 198
            ||..: |..:..::.|  .::|....:||.:::...:.:...:.|||.|||.|.|||||||:.|.
Human    17 CGVPSFPPNLSARVVG--GEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNFVLTAAHCISNT 79

  Fly   199 QPSSIVVRAGEWDTQTQTEIRRHEDRY---VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQ 260
            :...:.|      .:...|:...|...   |..|..|:::|...|.||:|::.|.....|.:.||
Human    80 RTYRVAV------GKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQ 138

  Fly   261 TVCLPNVGDKFDFD-RCYATGWGK 283
            ..|||........| .||.||||:
Human   139 VACLPEKDSLLPKDYPCYVTGWGR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 43/135 (32%)
Tryp_SPc 153..390 CDD:214473 43/135 (32%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 44/142 (31%)
Tryp_SPc 30..>173 CDD:238113 44/141 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.