DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:270 Identity:86/270 - (31%)
Similarity:133/270 - (49%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DHPEG--CG---YQNPNG-VGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVV 188
            |.|..  ||   ..:.|| ||.:.:.||:       :||..::....|.    .|||:||....|
Zfish   290 DSPSAAVCGIIPVNSSNGTVGGQNSSAVH-------WPWQASLYWYSGQ----TCGGSLINKEWV 343

  Fly   189 LTAAHCVHNKQPS-SIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESP 252
            |:||||.:.::.. .:.|..|. .||.:.:..| ..|.||.:|.|..:|..:..||:|::.|..|
Zfish   344 LSAAHCFNGQRNGFYLTVILGP-KTQNKYDPSR-ISRSVKAVIKHPYYNPNTNDNDIALVRLSFP 406

  Fly   253 FTLQENIQTVCLPNVGDKFDFD-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRET 316
            .|..::|:.|||...|..|:.| ..:.|.|.....|.......|.::|::||:..:||..     
Zfish   407 ITFTDSIRPVCLAAEGSVFNSDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNC----- 466

  Fly   317 RLGRHFILHDSFICAGGEKD-KDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVY 380
             |.....:.|:.||||..|: ||.|:||.|.|:|   :.|.:.:..:|||::|.||.:...||||
Zfish   467 -LYGVGSITDNMICAGLLKEGKDLCQGDSGGPMV---SNQSSVWVQSGIVSFGSGCAQSEFPGVY 527

  Fly   381 ASVAKLRPWI 390
            ..|::.:.||
Zfish   528 TRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/241 (32%)
Tryp_SPc 153..390 CDD:214473 74/239 (31%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 78/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.