DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Try5

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:253 Identity:81/253 - (32%)
Similarity:121/253 - (47%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEW 210
            ||.|...  ......|:.:::     |...:.|||:||....|::||||...:    |.||.||.
Mouse    23 KIVGGYT--CRENSIPYQVSL-----NSGYHFCGGSLINDQWVVSAAHCYKTR----IQVRLGEH 76

  Fly   211 DTQTQTEIRRHEDRYVK--EIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPN----VGD 269
            :    ..:....:::|.  :||.|..||..:|.||:.::.|.||.||...:.||.||:    .| 
Mouse    77 N----INVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVALPSSCAPAG- 136

  Fly   270 KFDFDRCYATGWGKN-KFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG 333
                .:|..:|||.. .||.:.  ..:|:.:|.|::|:..||.:..    |:   :.::.||.|.
Mouse   137 ----TQCLISGWGNTLSFGVNN--PDLLQCLDAPLLPQADCEASYP----GK---ITNNMICVGF 188

  Fly   334 -EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
             |..||:|:||.|.|:||  .||..     |||:||.||...:.||||..|.....||
Mouse   189 LEGGKDSCQGDSGGPVVC--NGQLQ-----GIVSWGYGCALKDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 78/246 (32%)
Tryp_SPc 153..390 CDD:214473 76/244 (31%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 79/251 (31%)
Tryp_SPc 24..242 CDD:238113 80/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.