DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG42694

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:230 Identity:56/230 - (24%)
Similarity:86/230 - (37%) Gaps:49/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CGGALIAPNVVLTAAHC--VHNKQPSSIVVRAG--------EWDTQTQTEIRRHEDRYVKEIIYH 232
            |.|:||:...||:||.|  ||.|    :.|:.|        .|.|.:...|..|..:.::..|..
  Fly    58 CSGSLISKQFVLSAAQCIDVHGK----LFVQLGVSNATKSPHWYTVSNVVIPSHSGKRLQRDIGL 118

  Fly   233 EQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGW-GKNKFGKDGEYQVIL 296
            .:.::...|||...     |..:..|..|:.:..:...|.     .:.| .|||    ....::|
  Fly   119 LKLSQSVDYNDFVY-----PICIALNTNTLDMVKILQNFT-----TSAWLSKNK----NPQTIVL 169

  Fly   297 KKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKN---- 357
            .::.     ..:|:.||......:.       |||...:..::|..|.||.|..||....|    
  Fly   170 SQLS-----RDRCKLNLSGNVTPKE-------ICAASLQRNNSCFIDSGSALTQPIIQGSNIVRE 222

  Fly   358 -RFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID 391
             .|...|.|.....|.|   |.:|..||:...||:
  Fly   223 MLFGIRGYVNGRSWCSE---PAIYIDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 55/228 (24%)
Tryp_SPc 153..390 CDD:214473 54/227 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 56/230 (24%)
Tryp_SPc 46..253 CDD:214473 54/227 (24%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.