DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:428 Identity:105/428 - (24%)
Similarity:173/428 - (40%) Gaps:88/428 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CLVIC----LCIF---------SC--GAQDSSLDKLISDIFKTDETPKPSSPPPPVVNPK--DSS 53
            |.::|    :|:.         .|  |..:.:..:|....|:........:...||...:  |:|
 Frog   127 CQMLCGSSGVCVLYSQWCDGIPQCPNGTDEQTCVRLYGPNFQLQAYSPAKATWLPVCYDEWSDNS 191

  Fly    54 GSTGSEN-GGSSSTQYQSCGDQKECVPRWLCANDTINTSGDGIIDIR-----------LGTDAEC 106
            |....:: |.|.|:.|||              :..:.:|.:|...::           |...|.|
 Frog   192 GKIACQDIGYSMSSYYQS--------------SQLLASSSNGYFVLQSSNVTGKMYTNLNYSATC 242

  Fly   107 K--NYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILRE 169
            .  |.:.|.|                  ..||....  |..:|.|..  .|..|::||.:.:|:.
 Frog   243 ASGNMVSLRC------------------ISCGLSTK--VDSRIVGGT--PASVGDWPWQVELLKL 285

  Fly   170 EGNLNLYECGGALIAPNVVLTAAHCVH--NKQPSSIVVRAGEWDTQTQTEIRRHEDRY-VKEIIY 231
            .|. ::|.|||::|.|:.::||||||:  ...||:..|.||....|:.     :...| |:..:.
 Frog   286 VGT-SIYLCGGSIITPHWIVTAAHCVYGSTSTPSAFKVFAGSLTIQSY-----YSAGYTVERALV 344

  Fly   232 HEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF-DFDRCYATGWGKNKFGKDGEYQVI 295
            |..::..:...|||::.|.:......|::.|||||||..: :...|:.:|||....|  |.....
 Frog   345 HPSYSSYTQIYDVALLKLTAALVFTTNLRPVCLPNVGMPWAEGQPCWISGWGTTAEG--GSISKN 407

  Fly   296 LKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRF 359
            |....:|::....|  |......|   .:..:.:|||. ....|||:||.|.|||   ....:.:
 Frog   408 LMAASVPIISSTTC--NQAAVYGG---AISSTMMCAGYLSGGTDTCQGDSGGPLV---TKTNSLW 464

  Fly   360 KSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLKIW 397
            ...|..:||.||.....||||.:|.....||.::::.:
 Frog   465 WLVGDTSWGYGCARAYKPGVYGNVTVFIEWIYSQMQTY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 73/242 (30%)
Tryp_SPc 153..390 CDD:214473 72/241 (30%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 22/126 (17%)
Tryp_SPc 265..498 CDD:238113 76/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.