DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CELA3A

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_005738.4 Gene:CELA3A / 10136 HGNCID:15944 Length:270 Species:Homo sapiens


Alignment Length:247 Identity:64/247 - (25%)
Similarity:116/247 - (46%) Gaps:37/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 FPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDR 224
            :||.:::..|:.....:.|||:||||:.|:||.||:.......:|:  ||::    ..::...::
Human    40 WPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVL--GEYN----LAVKEGPEQ 98

  Fly   225 YV----KEIIYHEQFNKGSLY--NDVAVMLLESPFTLQENIQTVCLPNVGDKF-DFDRCYATGWG 282
            .:    :|:..|..:|:..:.  ||:|::.|.....|.:.:|...||..||.. :...||.||||
Human    99 VIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWG 163

  Fly   283 KNKFGKDGEYQVILKKVDMPVVPEQQCE------TNLRETRLGRHFILHDSFICAGGEKDKDTCK 341
              :...:|.....|::..:|||..:.|.      :.:::|           .:|||| ..:..|.
Human   164 --RLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKT-----------MVCAGG-YIRSGCN 214

  Fly   342 GDGGSPLVCPIAGQKNRFKSAGIVAW--GIGCGEVNIPGVYASVAKLRPWID 391
            ||.|.||.||.  :...::..|:.::  ..||..:..|.|:..|:....||:
Human   215 GDSGGPLNCPT--EDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 63/245 (26%)
Tryp_SPc 153..390 CDD:214473 62/244 (25%)
CELA3ANP_005738.4 Tryp_SPc 28..263 CDD:214473 62/244 (25%)
Tryp_SPc 29..266 CDD:238113 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.