DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and XB5962685

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_002941155.3 Gene:XB5962685 / 100496550 XenbaseID:XB-GENE-5962686 Length:251 Species:Xenopus tropicalis


Alignment Length:270 Identity:70/270 - (25%)
Similarity:117/270 - (43%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PNGVGFKITG---AVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPS 201
            |...|..|||   |:.....:      :|::|...||    |||.||..|.|||||.|   |...
 Frog    16 PICAGMGITGGKEAIPHARRY------MALVRTGSNL----CGGTLIKDNWVLTAATC---KVDR 67

  Fly   202 SIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPN 266
            :..|..|....:|..::|  :...|...:.|::|::.|..|::.::.|.|.......:..:.||.
 Frog    68 TTTVDLGVHSIKTMNKLR--QQFKVARWVPHQKFDRRSYVNNLQLLQLSSKANFSYAVNILLLPT 130

  Fly   267 VGDKFDFDR----CYATGWGKNKFGKDGEYQV-ILKKVDMPVVPEQQC----ETNLRETRLGRHF 322
               |:...:    |...|||...:  :|:.|. .|.:|.:.|:...||    ::.::.|:     
 Frog   131 ---KYKDIKPGTVCETAGWGITAY--NGKQQSDKLMEVSLTVLDRMQCNNQWKSKIKITK----- 185

  Fly   323 ILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWG-IGCGEVNIPGVYASV-AK 385
                ..:|...:..:..|.||||.||:|      ||..: |::::| :.||..|...||..: :.
 Frog   186 ----DMMCTRDKGKRGFCNGDGGGPLIC------NRILT-GVISFGPLICGMENGANVYTRLTSN 239

  Fly   386 LRPWIDAKLK 395
            ...||..:.|
 Frog   240 YIKWIKKETK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 62/248 (25%)
Tryp_SPc 153..390 CDD:214473 61/247 (25%)
XB5962685XP_002941155.3 Tryp_SPc 23..246 CDD:238113 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.