DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and LOC100495541

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:264 Identity:89/264 - (33%)
Similarity:130/264 - (49%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHC-VHNKQPSSI 203
            ||    :|.|  ...|..|.:||.:: ||.:|   ::.|||::|..:.:|||||| :.::.||..
 Frog    41 PN----RIVG--GSAATEGAWPWQVS-LRYKG---IHICGGSVIGTHWILTAAHCFLISQSPSDF 95

  Fly   204 VVRAGEWDTQ--TQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPN 266
            .||.|.:...  :..||....||    ||.:.||:..|.|.|:|::...||.|....|..||||:
 Frog    96 EVRLGAYQLSLTSPNEITYKVDR----IIVNSQFDSSSHYGDIALIRPTSPITYTPYILPVCLPS 156

  Fly   267 VGDKF-DFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCE------TNLRETRLGRHFIL 324
            ..:.| :...|:.||||...|..:..|...|::|..|::....|:      ||:..:..    |:
 Frog   157 TSNSFPEGMECWVTGWGTTAFQVNLPYPQTLQQVMTPLISRTSCDQMYHIGTNVPSSTA----II 217

  Fly   325 HDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRP 388
            ....|||| ....||:|:||.|.||||.:.|   .:...|.|.||.||...|.||||..|...:.
 Frog   218 PSDQICAGYAAGQKDSCQGDSGGPLVCKLQG---IWYQIGFVTWGDGCAIANRPGVYTLVPAYQS 279

  Fly   389 WIDA 392
            |:.:
 Frog   280 WLSS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 85/248 (34%)
Tryp_SPc 153..390 CDD:214473 84/247 (34%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113 87/255 (34%)
Tryp_SPc 362..595 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.