DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and prss8l.5 loc108703873

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_002939739.1 Gene:prss8l.5 loc108703873 / 100494289 XenbaseID:XB-GENE-22167980 Length:353 Species:Xenopus tropicalis


Alignment Length:267 Identity:84/267 - (31%)
Similarity:133/267 - (49%) Gaps:27/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199
            ||.:.   |..:|.|  .|:::.|.:||.:.|...:.:.    |||:||....|::|:||.:...
 Frog    27 CGTRQ---VSTRIMG--GQDSQQGMWPWQVNIRSNDFSF----CGGSLITSKWVISASHCFNRTN 82

  Fly   200 PSSI-VVRAGEWDTQTQTEIRRHE-DRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTV 262
            |.|. .|..|.:..   |....:| ...::..|.|..:......:|:.::.|.|.......||.|
 Frog    83 PPSFYTVYLGSYQL---TGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYIQPV 144

  Fly   263 CLPNVGDKFDFD-RCYATGWG---KNKFGKDGEYQVILKKVDMPVVPEQQCETNLR-ETRLG-RH 321
            |||:.|..|... :|:.||||   .|...:|..   .|::|.:|::..|||.:.|: .:.|| ..
 Frog   145 CLPSAGVNFPTGLQCWVTGWGNIASNVSLRDPN---TLQQVAVPLIGNQQCNSILQAPSPLGPSS 206

  Fly   322 FILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAK 385
            |.:.:..:|||. :..||:|:||.|.||||..|   |::...|:|::|.|||:.|.||||..|..
 Frog   207 FAILNDMLCAGYIDGGKDSCQGDSGGPLVCAAA---NQWYLVGVVSFGDGCGQPNRPGVYVRVTA 268

  Fly   386 LRPWIDA 392
            ...||::
 Frog   269 YLDWIES 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 78/246 (32%)
Tryp_SPc 153..390 CDD:214473 77/245 (31%)
prss8l.5 loc108703873XP_002939739.1 Tryp_SPc 35..273 CDD:214473 79/252 (31%)
Tryp_SPc 36..275 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.