DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and LOC100490440

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_002939183.3 Gene:LOC100490440 / 100490440 -ID:- Length:565 Species:Xenopus tropicalis


Alignment Length:334 Identity:64/334 - (19%)
Similarity:103/334 - (30%) Gaps:122/334 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DHPEGCGYQNPNGV-----GFKI---------TGAVNQEAEFGEFPWMLAILREEGNLNLYECGG 180
            |:|   ||...:.|     |.|:         .|....:.|.    .:|..|:::|.        
 Frog    89 DYP---GYNPADSVASYLDGIKLDTVQYLLVTVGEAVSDTEL----QLLGTLKQKGK-------- 138

  Fly   181 ALIAPNVVLTAAHCVHNKQPSSIV----VRAGE--WDTQTQTEIR-RHEDR-----------YVK 227
                       .||:.......::    .|.|:  |..||...|| |.|:|           ::.
 Frog   139 -----------PHCMVQTHADLVLHTEKRRQGKSYWRRQTLQGIRSRVEERLVGAGLQGCKAFLI 192

  Fly   228 EIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEY 292
            ..:..:.|:..|:.:.:...:|:.|.:.::|::..|...| ..|:.. |...|     ..:...|
 Frog   193 SALEPQSFDFPSMMDYMEGEILQWPRSGEDNVENQCQELV-SVFEMP-CDQEG-----LVEFPPY 250

  Fly   293 QVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDK-------DTCKGDGGSPL-- 348
            ..||..:..||........:.::|      |||       |..|.       ....|.|..||  
 Frog   251 LSILLDIPPPVPAIVGVAGSNKDT------ILH-------GLSDPPMSGLLVKALPGPGNPPLPV 302

  Fly   349 ----------VCPI-----AGQKNRFKSA---GIVAWGIGC----------GEVNIPG------- 378
                      .|.:     :|..|.|::.   .:||.|..|          ||...||       
 Frog   303 DQYLENLQLESCDVYLIVESGLNNSFRATLVEALVAAGKHCMLIAGEGRQSGEEKEPGHDGEGKR 367

  Fly   379 VYASVAKLR 387
            .|.....||
 Frog   368 AYLGATDLR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 56/297 (19%)
Tryp_SPc 153..390 CDD:214473 56/297 (19%)
LOC100490440XP_002939183.3 P-loop_NTPase 32..218 CDD:422963 27/154 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.