DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and akt1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_004917247.1 Gene:akt1 / 100490038 XenbaseID:XB-GENE-484953 Length:493 Species:Xenopus tropicalis


Alignment Length:258 Identity:50/258 - (19%)
Similarity:85/258 - (32%) Gaps:81/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 VVLTAAHCVHNKQPSSIVVRAGEWDTQT----QTEIRRHEDRY---VKEIIYHEQFNKGS----- 239
            |:...|..:..::...:.||:|:..:..    :.|:...:.::   :.|..|.:...||:     
 Frog   102 VIQHVADNLKKQEEEMMEVRSGDSPSDNSGAEEMEVSHSKPKHKVTMNEFEYLKLLGKGTFGKVI 166

  Fly   240 ---------------LYNDVAVMLLESPFTLQEN--IQTVCLP---------NVGDKFDFDRCYA 278
                           |..:|.|...|...||.||  :|....|         ...|:..|...||
 Frog   167 LVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYA 231

  Fly   279 TGW-------GKNKFGKD-----------------GEYQVILKKVDMPVVPEQQCETNLRETRLG 319
            .|.       .:..|.:|                 .|..|:.:.:.:         .||...:.|
 Frog   232 NGGELFFHLSRERIFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKL---------ENLMLDKDG 287

  Fly   320 RHFILHDSFICAGGEKDKDTCKGDGGSP-LVCPIAGQKNRFKSAGIVAWGIG-------CGEV 374
             |..:.|..:|..|.||..|.|...|:| .:.|...:.|.:..| :..||:|       ||.:
 Frog   288 -HIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRA-VDWWGLGVVMYEMMCGRL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 50/258 (19%)
Tryp_SPc 153..390 CDD:214473 50/258 (19%)
akt1XP_004917247.1 PH_PKB 4..111 CDD:269947 2/8 (25%)
PKc_like 125..491 CDD:419665 45/235 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.