DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and LOC100487305

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_017946453.2 Gene:LOC100487305 / 100487305 -ID:- Length:396 Species:Xenopus tropicalis


Alignment Length:266 Identity:80/266 - (30%)
Similarity:134/266 - (50%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYE--CGGALIAPNVVLTAAHCVHNKQPS----SIV 204
            :|.|.||.:.  |.:||:::|....|:...|.  |||.::....:||||||:.:.:.:    .:|
 Frog    47 RIVGGVNSQP--GAWPWLVSIQAWRGSDYGYGHFCGGTILNNQWILTAAHCLIDYKTTFDTIRVV 109

  Fly   205 VRAGEWD-TQTQTEIRRHEDRYVKEIIYHEQF-NKGSLYNDVAVMLLESPFTLQENIQTVCLP-- 265
            :.|.:.. ..::|:||:     ||::|.||:: .:|....|:.::||:.|....:..|..|||  
 Frog   110 IGARKLSKLGSETQIRK-----VKQLILHEKYLREGKHSYDIGLILLDEPIKFNDYTQRACLPSA 169

  Fly   266 --NVGDKFDFDRCYATGWG----KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFIL 324
              ||..|   ..||..|||    |.....|     ||::..:..:.::.|  |.:|...|:   :
 Frog   170 SLNVAQK---TNCYVAGWGVLEEKEIAAAD-----ILQEAGVFFINKELC--NSKEWYNGK---V 221

  Fly   325 HDSFICAGGEKDK-DTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRP 388
            :...:|||.::.| |:|:||.|.||:|. ....|.:...|:.:|||||.....||:|.|......
 Frog   222 YPYNLCAGHKEGKIDSCQGDSGGPLMCK-RKTSNDYIVVGVTSWGIGCARKQRPGIYISTQYFNE 285

  Fly   389 WIDAKL 394
            ||::|:
 Frog   286 WIESKI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/254 (29%)
Tryp_SPc 153..390 CDD:214473 73/253 (29%)
LOC100487305XP_017946453.2 Tryp_SPc 47..287 CDD:214473 77/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.