DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and zgc:165423

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:263 Identity:91/263 - (34%)
Similarity:130/263 - (49%) Gaps:25/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCV- 195
            |..||....|   .||.|..|..|  |.:||. |.|.|.|:   :.|||:||:...:|:||||. 
Zfish    26 PPACGKAPLN---TKIVGGTNASA--GSWPWQ-ASLHESGS---HFCGGSLISDQWILSAAHCFP 81

  Fly   196 HNKQPSSIVVRAG--EWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQEN 258
            .|..||...|..|  ..|.....|:    .:.|.::|.|..:...:..||:|::.|.||.|....
Zfish    82 SNPNPSDYTVYLGRQSQDLPNPNEV----SKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNY 142

  Fly   259 IQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFI 323
            ||.|||...|..|..|..:.||||..:.|.......||::|::|:|     ..||.....|....
Zfish   143 IQPVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIV-----GNNLCNCLYGGGSS 202

  Fly   324 LHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLR 387
            :.::.:||| .:..||:|:||.|.|:|..   ..|.:..||:|::|.||.:.|.|||||.|::.:
Zfish   203 ITNNMMCAGLMQGGKDSCQGDSGGPMVIK---SFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQ 264

  Fly   388 PWI 390
            .||
Zfish   265 NWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 83/242 (34%)
Tryp_SPc 153..390 CDD:214473 81/240 (34%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 85/247 (34%)
Tryp_SPc 38..269 CDD:238113 86/248 (35%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.