DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and f7l

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:399 Identity:111/399 - (27%)
Similarity:161/399 - (40%) Gaps:106/399 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ICLCIFSCGAQDSSLDKLISDIFKTDETPKPSSPPPPVVNPKDSSGSTGSENGG------SSSTQ 67
            ||:|  ....:....||.||                    |:.|.|.. ..|||      .:|..
Zfish   115 ICIC--PVNLEGRHCDKEIS--------------------PRSSFGCL-YRNGGCEHFCVETSET 156

  Fly    68 YQSCGDQKECVPRWLCANDTINTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHP 132
            ..||    :|.|.:...:|  |:|                     |.        |..:|     
Zfish   157 THSC----DCAPGYTLHSD--NSS---------------------CV--------PTADF----- 181

  Fly   133 EGCGYQNPNGVGFKIT-GAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVH 196
             .||.....|||.:|. |.|..:   |:.||. |:|..:|.   |:|||.::....::|||||:.
Zfish   182 -SCGRPVAKGVGPRIVKGDVCPK---GQCPWQ-ALLEYDGQ---YKCGGVILNSQWIITAAHCIW 238

  Fly   197 NKQPSSIVVRAGEW--DTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENI 259
            .|.|:.:.|..||.  |....||    :.|.|.|:..|.|:|..|..:|||::.|..|.||....
Zfish   239 RKDPALLQVIVGEHIRDRDEGTE----QMRKVSEVFLHPQYNHSSTDSDVALLRLHRPVTLGPYA 299

  Fly   260 QTVCLPNVGDKFDFDRCYA-------TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETR 317
            ..||||....  .|.|..|       :|||  :..:.|....:|:::.:|.|..:.|     ..|
Zfish   300 LPVCLPPPNG--TFSRTLASIRMSTVSGWG--RLAQSGPPSTVLQRLQVPRVSSEDC-----RAR 355

  Fly   318 LGRHFILHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYA 381
            .|  ..:..:.:||| .|..:|:|:||.|.|||   ...:|.:...|||:||.||...::.|:|.
Zfish   356 SG--LTVSRNMLCAGFAEGGRDSCQGDSGGPLV---TRYRNTWFLTGIVSWGKGCARADVYGIYT 415

  Fly   382 SVAKLRPWI 390
            .|:....||
Zfish   416 RVSVFVEWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 79/248 (32%)
Tryp_SPc 153..390 CDD:214473 77/246 (31%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.