DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and zgc:163079

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:316 Identity:93/316 - (29%)
Similarity:131/316 - (41%) Gaps:63/316 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NDTINTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITG 149
            |.....:|..:::|     |.|....|:|...|                         :..||.|
Zfish     4 NSVFCVAGAILLNI-----AGCLGQSDVCGRAP-------------------------LNTKIIG 38

  Fly   150 AVNQEAEFGEFPWMLAILREEGNLNLYE---CGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWD 211
            .:|  |..|.:||..:|     ||...|   |||:||....|||.|........|.|||..|.  
Zfish    39 GLN--ATQGSWPWQASI-----NLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGR-- 94

  Fly   212 TQTQTEIRRHE-DRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF-DFD 274
             |||.....:| .|.|.:||.|..:|  ||.:::|::.|.||.|..:.|:.|||...|..| |..
Zfish    95 -QTQNGSNPYEISRTVTKIIKHPNYN--SLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFVDGT 156

  Fly   275 RCYATGWG-KNKFGKDGEYQV--ILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG--GE 334
            ..:.|||| .|:.....|..:  :|::|:.|:|...:|..       ....|:.:..:|||  .|
Zfish   157 ASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNA-------AYGGIITNKLLCAGYLNE 214

  Fly   335 KDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            ..|..|.||.|.|||..   |...:..:|:|..|. ||....|.:|..|::...||
Zfish   215 DGKAPCAGDVGGPLVIK---QGAIWIQSGVVVSGY-CGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 81/248 (33%)
Tryp_SPc 153..390 CDD:214473 79/246 (32%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 83/253 (33%)
Tryp_SPc 36..267 CDD:238113 84/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.