DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and LOC100004427

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:336 Identity:92/336 - (27%)
Similarity:133/336 - (39%) Gaps:95/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NDTINTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITG 149
            |.....:|..:::|     |.|....|:|...|                         :..||.|
Zfish     4 NTVFCVAGAVLLNI-----AGCLGQSDVCGRAP-------------------------LNTKIVG 38

  Fly   150 AVNQEAEFGEFPWMLAI-LREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQ 213
            .:|  |..|.:||..:| .:..|.   :.|.|:||:...|||||.|......|.:|:..|...|.
Zfish    39 GLN--ATEGSWPWQASINFKSTGQ---FFCSGSLISERWVLTAASCFQRINVSDVVIYLGRLTTN 98

  Fly   214 TQT--EIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF-DFDR 275
            ...  ||    .|.|.::         |:..|:|::.|.|..|..:.|:.|||...|..| |...
Zfish    99 GSNPYEI----PRTVIQV---------SVTEDIALVQLSSSVTFTDYIRPVCLAAAGSVFVDGTE 150

  Fly   276 CYATGWGK----NKFGKDGEYQVILKKVDMPVVPEQQCE-----TNLRETRLGRHFILHDSFICA 331
            .:.||||.    |....|     :||:|:.|:|...:|.     |||            |:.|||
Zfish   151 SWVTGWGSTSSTNVILSD-----MLKEVEAPIVNNIECSNINGITNL------------DNVICA 198

  Fly   332 G--GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKL 394
            |  .|..|..|..|.|||||   ..|.:::..:|:|.:.. ||:...|.:||.|::...||    
Zfish   199 GFVNETGKAPCWEDFGSPLV---TRQGSQWIQSGVVVFTF-CGQNGFPTLYARVSEYEEWI---- 255

  Fly   395 KIWSIDPRHYT 405
                   |:||
Zfish   256 -------RNYT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/252 (30%)
Tryp_SPc 153..390 CDD:214473 75/251 (30%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 79/258 (31%)
Tryp_SPc 36..257 CDD:238113 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.