DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and zgc:171592

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001104713.2 Gene:zgc:171592 / 100003031 ZFINID:ZDB-GENE-080220-23 Length:260 Species:Danio rerio


Alignment Length:266 Identity:87/266 - (32%)
Similarity:130/266 - (48%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GCGYQ--NPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVH 196
            |||..  .|..:|.:|..  .|.|..|.:||.:::....|   ::.|||:||..|.|||||||  
Zfish    16 GCGVPAIKPQIIGSRIVN--GQNAISGSWPWQVSLQLPNG---VHFCGGSLINRNWVLTAAHC-- 73

  Fly   197 NKQPSSIVVR-----AGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQ 256
                 |:||.     .||.|..:..|  ..:.:.|.:::.|..|::.:|.||:|::.|.||.||.
Zfish    74 -----SVVVGYHRVVLGEHDRGSNAE--PIQVKLVSKVVTHPLFSRTTLNNDIALLKLASPVTLT 131

  Fly   257 ENIQTVCL-PNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGR 320
            ..:..||| |:..:.....||:.||||:........   ||::..:|:|....|.......|   
Zfish   132 ARVSPVCLAPSAINIQSGTRCFTTGWGRTASTSSPR---ILQQTSVPLVSHADCRQIWGRNR--- 190

  Fly   321 HFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAK 385
               :.|:.||||| ....:|:||.|.||||..:|.   :...|.|:||:.......|||||.:::
Zfish   191 ---VTDAMICAGG-SGSSSCRGDSGGPLVCERSGV---WTLVGSVSWGLDTCNTRFPGVYARISQ 248

  Fly   386 LRPWID 391
            .|.||:
Zfish   249 QRSWIN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 80/243 (33%)
Tryp_SPc 153..390 CDD:214473 79/242 (33%)
zgc:171592NP_001104713.2 Tryp_SPc 31..256 CDD:238113 82/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.