powered by:
Protein Alignment CG13138 and Psors1c2
DIOPT Version :9
Sequence 1: | NP_609372.1 |
Gene: | CG13138 / 34381 |
FlyBaseID: | FBgn0032211 |
Length: | 549 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001159488.1 |
Gene: | Psors1c2 / 686254 |
RGDID: | 1591981 |
Length: | 134 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 15/70 - (21%) |
Similarity: | 27/70 - (38%) |
Gaps: | 5/70 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 334 PPPREHEP-SSLPSSNYYNRIYKSRELDHPPRMEDYQSSVPTQLKHDYATKTNLDQQFKNEYVTK 397
|||..:.| ..||.|..:.....|.:...||..:|...:.....::.:.....:|.:.:.|
Rat 63 PPPGSNRPWRDLPDSGAWPPKPPSTDPPKPPLPDDPWPAGTQPPENPWPPAPEMDSESQEE---- 123
Fly 398 SSIDP 402
..:||
Rat 124 PDLDP 128
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13138 | NP_609372.1 |
IMCp |
188..279 |
CDD:289112 |
|
Psors1c2 | NP_001159488.1 |
SPR1 |
24..134 |
CDD:292000 |
15/70 (21%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMI8 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.