DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and NEFH

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_066554.2 Gene:NEFH / 4744 HGNCID:7737 Length:1020 Species:Homo sapiens


Alignment Length:591 Identity:121/591 - (20%)
Similarity:203/591 - (34%) Gaps:149/591 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AHSNSYAVNKTNSVESAEW------SYPEYGKGSTHNTGRRSEKLDLQHYNRETERNVTLKRGVK 81
            |....:||..|  ::|.||      ...|..|.:|  ...||.:.::..|.|:.:...|      
Human   276 AQLEGHAVQST--LQSEEWFRVRLDRLSEAAKVNT--DAMRSAQEEITEYRRQLQARTT------ 330

  Fly    82 NYQKQGDKMTRNKLKYKPSGARRKNVSPNYADESTESRHYHTFEEIHEHIDEDDGQYQASE-QVG 145
              :.:..|.|::.|:.:.|              ..|.||........|.|.:.|.:.:.:: ::.
Human   331 --ELEALKSTKDSLERQRS--------------ELEDRHQADIASYQEAIQQLDAELRNTKWEMA 379

  Fly   146 TQAILHEHVEHSSKKDAKRMKVKIKHHHHHHHHNHIKELIK-------------TVPQPYP-VEK 196
            .|  |.|:.:..:.|.|  :.::|..:         ::|::             ::|:..| :..
Human   380 AQ--LREYQDLLNVKMA--LDIEIAAY---------RKLLEGEECRIGFGPIPFSLPEGLPKIPS 431

  Fly   197 V-VHVPIEKIVEKIVHVPKLVNVTVEKIVHVPIEKIVEKVIHIPKPVQVPKPYVVEKIIEKI--- 257
            | .|:.: |..|||..|.|....||          |||:        |..:..|.|::.|:.   
Human   432 VSTHIKV-KSEEKIKVVEKSEKETV----------IVEE--------QTEETQVTEEVTEEEEKE 477

  Fly   258 --------------------VHVPKPYPVLRTVPYPVEIKVPVHLEKKVPVPYK--VEVERKVPV 300
                                ....|..|.........|.|.||..|.|.|...|  .:.|.|.|.
Human   478 AKEEEGKEEEGGEEEEAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKSPA 542

  Fly   301 YIRSSE----PYKFESSSLYES-YPRGEEFKFNMEMDHP-----PPREHEPSSLPSSNYYNRIYK 355
            .::|.|    |.|.|:.|..|: .|..||.|...|:..|     |.:|...|...:        |
Human   543 EVKSPEKAKSPAKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEA--------K 599

  Fly   356 SRELDHPPRMEDYQSSV------------PTQLKHDYATKTNLDQQFKNEYVTKSSIDPQFKHDY 408
            |.|....|..|:.:|..            |.::|.....|:...::.|:....||....:.|...
Human   600 SPEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEKAKSPEKEEAKSPE 664

  Fly   409 VTKSSIDPQFKHDYVTKSSIDPQFKHDYVTKSSFDSQYNQEYVPKTSI--ESTSP--GRDGVSLK 469
            ..||.:..:.|.....||.:..:.|.....||....:.......|:.:  |:.||  .:..|..:
Human   665 KAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEE 729

  Fly   470 LVGP---PTPFNITGKDLETANSAPDFVNSSNVDLSPQESANAYRGMPFSIPFQFVQLQPMAFQS 531
            ...|   .:|.....|..|.|.| |:  .:..:|:...|:....:....|...:|    |...:|
Human   730 AKTPEKAKSPVKEEAKSPEKAKS-PE--KAKTLDVKSPEAKTPAKEEARSPADKF----PEKAKS 787

  Fly   532 PIHVEL 537
            |:..|:
Human   788 PVKEEV 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112 23/115 (20%)
NEFHNP_066554.2 Head 1..100
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..83
Filament 96..412 CDD:278467 32/174 (18%)
Coil 1A 101..132
Linker 1 133..145
Coil 1B 146..244
Linker 12 245..266
Coil 2A 267..288 4/13 (31%)
Linker 2 289..292 1/2 (50%)
Coil 2B 293..413 25/156 (16%)
BASP1 513..736 CDD:283191 54/230 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.