DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and CG13840

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_651102.3 Gene:CG13840 / 42705 FlyBaseID:FBgn0039028 Length:466 Species:Drosophila melanogaster


Alignment Length:417 Identity:80/417 - (19%)
Similarity:136/417 - (32%) Gaps:149/417 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSTAHSNSYAVNKTNSVESAEWSYPEYGK---GSTHNTGRRSEKLDLQ---------HYNRETER 72
            |.|.::.:|......:......:|..|..   .:||....|..:..|.         :||.:...
  Fly    52 GLTGYTRNYYGPTDTAAGDDLATYGNYAHKLLAATHQQHHRHSQSSLGTTANGFVPFYYNSKLHS 116

  Fly    73 NVTLKRGVKNYQKQGDKMTRNKLKYKPSGARRKNVSPNYADESTESRHY---------------H 122
            ..|.....:...........|...|:|:.| ..:|.|::.::..||..|               :
  Fly   117 PFTADEEPRRDPSANIDFVINTANYEPNSA-GYDVEPHHGEQHYESYAYRPRVQFATSLPGPSDY 180

  Fly   123 TFEEIHEHIDEDDGQYQASEQVGTQAILHEHVEHSSKKDAKRMKVKIK----------------- 170
            .||:|        ..|:.:.|...:...|:..:|..::|...:..::|                 
  Fly   181 HFEQI--------SNYRENRQREQEVEQHQQQQHQEQEDITSIYARLKELQTPANPVKRQQEESL 237

  Fly   171 --HH------------HH--------------------------------HHH-----------H 178
              ||            |:                                ||.           :
  Fly   238 SSHHPNREQSQPLEQRHYQQPESRQLQQPHLQQHLQQKRPHALQYPQDQRHHQRLGVAQDQQMLY 302

  Fly   179 NHIKELIKTVP--------QPYPVEKVVHVPIEKIVEKIVHVPKLVNVTVEKIVHVPIEKIVEKV 235
            :|....|..:|        .|...:.|..:|:.|.:|    :.|.|.:|..:..|||.::.|:  
  Fly   303 SHKDSQIADLPAITTSVHHTPESSKAVAGLPLAKHIE----ITKSVPITHYQKQHVPFKQNVQ-- 361

  Fly   236 IHIPKPV--QVPKPYVVEKIIEKIVHVP------------KPYPVLRTVPYPVEIKVPVHLEKKV 286
            :.:|:.|  .:|||..::..:.:.|.||            ||.||.|.:|:.||.:||..:||.|
  Fly   362 VQVPRTVIAAIPKPMPIKIPVAQTVAVPQMQEVKIPIERVKPVPVERPIPFVVERRVPYRVEKPV 426

  Fly   287 ------PVPYKVEVERKV-----PVYI 302
                  |.|.||.|.|.|     |.|:
  Fly   427 VSPVYYPYPVKVPVVRTVVHKQRPHYV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112 29/112 (26%)
CG13840NP_651102.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.