DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and CG7031

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001287474.1 Gene:CG7031 / 42704 FlyBaseID:FBgn0039027 Length:475 Species:Drosophila melanogaster


Alignment Length:330 Identity:78/330 - (23%)
Similarity:133/330 - (40%) Gaps:93/330 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IPGYLFITLIIIGS--TAHSNSYAVNKTNSVESAE--------WSYPEYGKGS-----THNTGRR 57
            :|.|        ||  :.|...||...:::.|..:        ::|.:...|:     ..::|..
  Fly   192 LPAY--------GSAGSGHEQDYAQWSSSAPEEQQPEQQAAHPYAYDKISMGNFLPPYMQDSGYD 248

  Fly    58 SEKLDLQHYNRETERNVTLKRGVKNYQKQGDKMTRNKLKYKPS-----------GARRKNVSPNY 111
            .::..|.|...:.::....::.::..|:|..::...:.:.:..           |....::|.:.
  Fly   249 DQQGQLYHQQLQHQQQQQQQQHLQQLQQQQQQLYHQQQQQQQQRQEQEQHSSYFGHHEPSISGSA 313

  Fly   112 ADESTESRHYHTFEEIHEHIDEDDGQYQASEQVGTQAILHEHVEHSSKKDAKRMKVKIKHHHHHH 176
            |..::.:......::..||  .|.||.|:|..:.         |.|.            |...|.
  Fly   314 ASSASSASSGSGADDFEEH--PDAGQEQSSNYLS---------EASG------------HGQGHT 355

  Fly   177 HHNHIKELIKTVP------QPYPVEKVVHVPIEKIVEKIVHVPKLVNVTVEKIVHVPIEKIVEKV 235
            ||:|..::|..||      |..||||.|.:||...|...|..|..:::.:.|.||||:|      
  Fly   356 HHSHHVDIINYVPVKHVKKQHVPVEKEVKIPISHAVIIPVRKPVPIHIPITKNVHVPVE------ 414

  Fly   236 IHIPKPVQVPKPYVVEKIIEKIVHVPKPYPVLRTVPYPVEIKVPVHLEK----KVPVPYKVEVER 296
                |.::||    ||::|        |.||.:.:|.|||..||.|:.|    |||.|:.|    
  Fly   415 ----KELKVP----VERLI--------PVPVEKHIPVPVEKHVPYHVVKYVPIKVPKPFPV---- 459

  Fly   297 KVPVY 301
            ||||:
  Fly   460 KVPVF 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112 32/96 (33%)
CG7031NP_001287474.1 IMCp 398..>469 CDD:289112 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.