DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and Vajk2

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_609689.3 Gene:Vajk2 / 34811 FlyBaseID:FBgn0032538 Length:270 Species:Drosophila melanogaster


Alignment Length:209 Identity:81/209 - (38%)
Similarity:103/209 - (49%) Gaps:59/209 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 ASEQVGTQAILHEHVEHSSKKDAKRMKVKIKHHHHHHH--------------------------- 177
            |||:...:|:  |..|.:.||..||   .|.|...:.:                           
  Fly    19 ASEEAPKKAV--ETAEPAEKKQEKR---GIGHGLGYGYGPSAGGAILGSGIGVGVPVAPAVAELP 78

  Fly   178 -HNHIKELIKTVPQPYPVEKVVHVPIEKIVEKIVHVPKLVNVTVEKIVHVPIEKIVEKVIHIPKP 241
             ..|...:::||..||.||:.|..|:||.|...|.||......||||||||:::|| ||     |
  Fly    79 TQVHTNTVVRTVQVPYQVERHVPYPVEKTVTYPVKVPVPQPYPVEKIVHVPVKQIV-KV-----P 137

  Fly   242 VQVPKPYVVEKIIE---KI-------VHVPKPY--PVLRTVPYPVE----IKVPVHLEKKVPVPY 290
            |:||:||.|||:|.   ||       |||.|||  ||.:.|||.||    .|||||:|:  ||||
  Fly   138 VEVPQPYPVEKVIRVPVKIPVDRPYTVHVDKPYPVPVEKPVPYTVEKRVIHKVPVHVER--PVPY 200

  Fly   291 KVEVERKVPVYIRS 304
            ||.|  .|||::.|
  Fly   201 KVAV--PVPVHVES 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112 51/106 (48%)
Vajk2NP_609689.3 Tir_receptor_C 32..>97 CDD:284826 12/67 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.