DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and Vajk1

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_609688.3 Gene:Vajk1 / 34809 FlyBaseID:FBgn0028938 Length:373 Species:Drosophila melanogaster


Alignment Length:341 Identity:99/341 - (29%)
Similarity:141/341 - (41%) Gaps:105/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 EHSSKKDAKRMKVKIKHHHHHHHHNHIKE----------LIKTVPQPYPVEKVVHVPIEKIVEKI 209
            |.::.:|..:.|..: ||:..:||:|:..          :||.||.|.|:||:||||    |||.
  Fly    45 EAAASEDTTKSKRGL-HHYEDYHHHHVPHFPVHEEKTLTVIKKVPVPVPIEKIVHVP----VEKH 104

  Fly   210 VHVPKLVNV----------------------------TVEKIVHVPIE---------KI------ 231
            :|||..|.|                            .|||.||||:.         |:      
  Fly   105 IHVPVKVKVPKPYPVIKHIPYEVKEIVKVPYEVPAPYPVEKQVHVPVHVHYDRPVPVKVHVPAPY 169

  Fly   232 -VEKVIHIPKPVQVPKPYVVEKI----IEKIVHVPKPYPVLRTVPYPVEI--------------- 276
             |||.:|:|..|.||.||.||||    :||.|||.|||||.:.|.|||::               
  Fly   170 PVEKKVHVPVKVHVPAPYPVEKIVHYNVEKHVHVDKPYPVEKVVHYPVKVPVDKPVPHYIDKPVP 234

  Fly   277 -----KVPVHLEKKVPVPYKVEVERKVPVYIRSSEPYKFESSSLYESYPRGEEFKFNMEMDHP-- 334
                 .|||.:.||||||..|..:|.|||::....||:.: ..:...||..:|....:|...|  
  Fly   235 HYVDKPVPVPVIKKVPVPVHVPYDRPVPVHVEKPVPYEVK-VHVPAPYPVIKEVPVKVEKHVPYP 298

  Fly   335 -------PPREHEPSSLPSSNYYNRIYKSRELDHPPRMEDYQSSVPTQLKHDYATKTNLDQQFKN 392
                   |...|....:|..:..:..||..|..|....||:..:   .:.|........:.:.::
  Fly   299 VKIPVEKPVHVHIEKHVPEYHEKHVTYKEPEFHHKHIEEDHHHA---PIHHHSHPIVEHEHEVEH 360

  Fly   393 EYVTKSSIDPQFKHDY 408
            |:.:         |||
  Fly   361 EFAS---------HDY 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112 54/158 (34%)
Vajk1NP_609688.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.