DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and Zfp512b

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001158069.1 Gene:Zfp512b / 269401 MGIID:2685478 Length:869 Species:Mus musculus


Alignment Length:270 Identity:65/270 - (24%)
Similarity:101/270 - (37%) Gaps:54/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KVKIKHHHHHHHHNHIKELIKTVPQPYPVEKVVHVPIEKIVEKIVHVPKLVNVTVEKIVHVPIEK 230
            |.:::.|...:|.:|    ....|:|.||.:.|.:.....|.|.:.|.|  .|||.|.|.|....
Mouse   153 KTQLEKHRIWNHMDH----PLPAPKPGPVSRPVTISRPVGVSKPIGVSK--PVTVGKPVGVSKPI 211

  Fly   231 IVEKVIHIPKPVQVPKPYVVEK--IIEKIVHVPKPYPVLRTVPYP--------VEIKVPVHLEKK 285
            .:.|.:.:.:|:.|.||..|.:  .:.:.|.|.||.|:.:.||..        |.:..||.|.|.
Mouse   212 GISKPVTVSRPIPVTKPVTVSRPMQVSRPVPVTKPIPITKPVPLTKHMPVTKLVTVSKPVPLTKP 276

  Fly   286 VPVPYKVEVERKVPVYIRSSEPY---------------KFESSSLYESYPRGEEFKFNMEMD--- 332
            |||...:.|.:.|||    |.|.               |.|:.:|..:.....:.:....:|   
Mouse   277 VPVSRPIVVSKPVPV----SRPIAISRHIPPCKMVLLSKSENKTLRATGKNSNKKRAADSLDTCP 337

  Fly   333 ------HPPPREHEPSSLPSSNYY--------NRIYKSRELDHPPRMEDYQSSVPTQLKHDYATK 383
                  .|....:.|||:..|..:        :|....:|...|..........|.:.||....|
Mouse   338 ILSKQARPENGAYGPSSMDQSVTFPLSTDPSGSRPLMGKEALRPIGPVSQPEEDPERTKHRRKQK 402

  Fly   384 TNLDQQFKNE 393
            |  .::|..|
Mouse   403 T--PKKFTGE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112 29/100 (29%)
Zfp512bNP_001158069.1 PRK12323 <170..425 CDD:237057 61/249 (24%)
C2H2 Zn finger 573..594 CDD:275368
C2H2 Zn finger 609..630 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.