DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and PSORS1C2

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_054788.2 Gene:PSORS1C2 / 170680 HGNCID:17199 Length:136 Species:Homo sapiens


Alignment Length:131 Identity:31/131 - (23%)
Similarity:45/131 - (34%) Gaps:58/131 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 PKPVQVPKPYVVEKIIEKIVHVPKPYPVLRTVPYPVEIKVPVHLEKKVPVPYKVEVERKVPVYIR 303
            |.|.:..:|:  ..:.|..|.:|:| |  ||.|               |.|         |   |
Human    64 PPPTRPSRPW--RDLPETGVWLPEP-P--RTDP---------------PQP---------P---R 96

  Fly   304 SSEPYKFESSSLYESYPRGEEFKFNMEMDHPPPREHEPSSLPSSNYYNRIYKSRELDHPPRMEDY 368
            ..:|           :|.|.:          ||....|   |:....||..:..:|| ||| |:|
Human    97 PDDP-----------WPAGPQ----------PPENPWP---PAPEVDNRPQEEPDLD-PPR-EEY 135

  Fly   369 Q 369
            :
Human   136 R 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112 11/39 (28%)
PSORS1C2NP_054788.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..136 30/129 (23%)
SPR1 23..136 CDD:292000 30/129 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.