powered by:
Protein Alignment CG13138 and PSORS1C2
DIOPT Version :9
Sequence 1: | NP_609372.1 |
Gene: | CG13138 / 34381 |
FlyBaseID: | FBgn0032211 |
Length: | 549 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_054788.2 |
Gene: | PSORS1C2 / 170680 |
HGNCID: | 17199 |
Length: | 136 |
Species: | Homo sapiens |
Alignment Length: | 131 |
Identity: | 31/131 - (23%) |
Similarity: | 45/131 - (34%) |
Gaps: | 58/131 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 239 PKPVQVPKPYVVEKIIEKIVHVPKPYPVLRTVPYPVEIKVPVHLEKKVPVPYKVEVERKVPVYIR 303
|.|.:..:|: ..:.|..|.:|:| | ||.| |.| | |
Human 64 PPPTRPSRPW--RDLPETGVWLPEP-P--RTDP---------------PQP---------P---R 96
Fly 304 SSEPYKFESSSLYESYPRGEEFKFNMEMDHPPPREHEPSSLPSSNYYNRIYKSRELDHPPRMEDY 368
..:| :|.|.: ||....| |:....||..:..:|| ||| |:|
Human 97 PDDP-----------WPAGPQ----------PPENPWP---PAPEVDNRPQEEPDLD-PPR-EEY 135
Fly 369 Q 369
:
Human 136 R 136
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMI8 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.